Lineage for d1oi9b1 (1oi9 B:175-309)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (78 PDB entries)
    Uniprot P20248 175-432
  8. 2000958Domain d1oi9b1: 1oi9 B:175-309 [103947]
    Other proteins in same PDB: d1oi9a1, d1oi9a2, d1oi9c1, d1oi9c2
    complexed with mg, n20, sgm

Details for d1oi9b1

PDB Entry: 1oi9 (more details), 2.1 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1oi9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi9b1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1oi9b1:

Click to download the PDB-style file with coordinates for d1oi9b1.
(The format of our PDB-style files is described here.)

Timeline for d1oi9b1: