Lineage for d1j9cl1 (1j9c L:48-86)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031272Domain d1j9cl1: 1j9c L:48-86 [103842]
    Other proteins in same PDB: d1j9ch_, d1j9ct1, d1j9ct2
    complexed with 0z6, ca, ful, glc, nag

Details for d1j9cl1

PDB Entry: 1j9c (more details), 2.9 Å

PDB Description: crystal structure of tissue factor-factor viia complex
PDB Compounds: (L:) factor VIIa light chain

SCOPe Domain Sequences for d1j9cl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9cl1 g.3.11.1 (L:48-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d1j9cl1:

Click to download the PDB-style file with coordinates for d1j9cl1.
(The format of our PDB-style files is described here.)

Timeline for d1j9cl1: