![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
![]() | Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
![]() | Protein Peptidase T (tripeptidase) [75443] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [103002] (1 PDB entry) |
![]() | Domain d1vixa2: 1vix A:208-320 [100778] Other proteins in same PDB: d1vixa1, d1vixa3, d1vixa4, d1vixb1, d1vixb3 structural genomics complexed with so4, zn |
PDB Entry: 1vix (more details), 2.5 Å
SCOPe Domain Sequences for d1vixa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vixa2 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Escherichia coli [TaxId: 562]} fnaasvnikivgnnvhpgtakgvmvnalslaarihaevpadespemtegyegfyhlasmk gtveradmhyiirdfdrkqfearkrkmmeiakkvgkglhpdcyielviedsyy
Timeline for d1vixa2: