PDB entry 1vix

View 1vix on RCSB PDB site
Description: Crystal structure of a putative peptidase T
Class: hydrolase
Keywords: structural genomics, Hydrolase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase T
    Species: Escherichia coli [TaxId:562]
    Gene: PEPT, B1127
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29745 (3-409)
      • cloning artifact (0-2)
      • cloning artifact (410)
    Domains in SCOPe 2.07: d1vixa1, d1vixa2, d1vixa3, d1vixa4
  • Chain 'B':
    Compound: Peptidase T
    Species: Escherichia coli [TaxId:562]
    Gene: PEPT, B1127
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29745 (3-409)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1vixb1, d1vixb2, d1vixb3
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vixA (A:)
    msldkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtl
    matlpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfp
    vlhqllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkg
    akhfdvdafdarwaytvdgggvgelefenfnaasvnikivgnnvhpgtakgvmvnalsla
    arihaevpadespemtegyegfyhlasmkgtveradmhyiirdfdrkqfearkrkmmeia
    kkvgkglhpdcyielviedsyynmrekvvehphildiaqqamrdcdiepelkpirggtdg
    aqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vixA (A:)
    msldkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtl
    matlpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfp
    vlhqllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkg
    akhfdvdafdarwaytvdgggvgelefenfnaasvnikivgnnvhpgtakgvmvnalsla
    arihaevpadespemtegyegfyhlasmkgtveradmhyiirdfdrkqfearkrkmmeia
    kkvgkglhpdcyielviedsyynmrekvvehphildiaqqamrdcdiepelkpirggtdg
    aqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vixB (B:)
    msldkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtl
    matlpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfp
    vlhqllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkg
    akhfdvdafdarwaytvdgggvgelefenfnaasvnikivgnnvhpgtakgvmvnalsla
    arihaevpadespemtegyegfyhlasmkgtveradmhyiirdfdrkqfearkrkmmeia
    kkvgkglhpdcyielviedsyynmrekvvehphildiaqqamrdcdiepelkpirggtdg
    aqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrkeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vixB (B:)
    msldkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtl
    matlpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfp
    vlhqllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkg
    akhfdvdafdarwaytvdgggvgelefenfnaasvnikivgnnvhpgtakgvmvnalsla
    arihaevpadespemtegyegfyhlasmkgtveradmhyiirdfdrkqfearkrkmmeia
    kkvgkglhpdcyielviedsyynmrekvvehphildiaqqamrdcdiepelkpirggtdg
    aqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrk