Lineage for d1vixb1 (1vix B:2-207,B:321-408)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889724Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2889813Protein Peptidase T (tripeptidase), catalytic domain [75250] (2 species)
  7. 2889814Species Escherichia coli [TaxId:562] [102506] (1 PDB entry)
  8. 2889816Domain d1vixb1: 1vix B:2-207,B:321-408 [100779]
    Other proteins in same PDB: d1vixa2, d1vixa3, d1vixa4, d1vixb2, d1vixb3
    structural genomics
    complexed with so4, zn

Details for d1vixb1

PDB Entry: 1vix (more details), 2.5 Å

PDB Description: crystal structure of a putative peptidase t
PDB Compounds: (B:) Peptidase T

SCOPe Domain Sequences for d1vixb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vixb1 c.56.5.4 (B:2-207,B:321-408) Peptidase T (tripeptidase), catalytic domain {Escherichia coli [TaxId: 562]}
dkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtlmat
lpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfpvlh
qllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkgakh
fdvdafdarwaytvdgggvgelefenXnmrekvvehphildiaqqamrdcdiepelkpir
ggtdgaqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrk

SCOPe Domain Coordinates for d1vixb1:

Click to download the PDB-style file with coordinates for d1vixb1.
(The format of our PDB-style files is described here.)

Timeline for d1vixb1: