| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
| Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
| Protein Peptidase T (tripeptidase), catalytic domain [75250] (2 species) |
| Species Escherichia coli [TaxId:562] [102506] (1 PDB entry) |
| Domain d1vixb1: 1vix B:2-207,B:321-408 [100779] Other proteins in same PDB: d1vixa2, d1vixa3, d1vixa4, d1vixb2, d1vixb3 structural genomics complexed with so4, zn |
PDB Entry: 1vix (more details), 2.5 Å
SCOPe Domain Sequences for d1vixb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vixb1 c.56.5.4 (B:2-207,B:321-408) Peptidase T (tripeptidase), catalytic domain {Escherichia coli [TaxId: 562]}
dkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtlmat
lpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfpvlh
qllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkgakh
fdvdafdarwaytvdgggvgelefenXnmrekvvehphildiaqqamrdcdiepelkpir
ggtdgaqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrk
Timeline for d1vixb1:
View in 3DDomains from other chains: (mouse over for more information) d1vixa1, d1vixa2, d1vixa3, d1vixa4 |