Lineage for d1visa2 (1vis A:181-312)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197530Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197552Family d.58.26.3: Mevalonate kinase [75450] (1 protein)
  6. 2197553Protein Mevalonate kinase [75451] (3 species)
  7. 2197559Species Methanococcus jannaschii [TaxId:2190] [75452] (2 PDB entries)
  8. 2197561Domain d1visa2: 1vis A:181-312 [100770]
    Other proteins in same PDB: d1visa1, d1visa3, d1visa4
    structural genomics
    complexed with dio

Details for d1visa2

PDB Entry: 1vis (more details), 2.69 Å

PDB Description: crystal structure of mevalonate kinase
PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d1visa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1visa2 d.58.26.3 (A:181-312) Mevalonate kinase {Methanococcus jannaschii [TaxId: 2190]}
eflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknkedfgklm
tknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekellkelnk
edvrifncrmmn

SCOPe Domain Coordinates for d1visa2:

Click to download the PDB-style file with coordinates for d1visa2.
(The format of our PDB-style files is described here.)

Timeline for d1visa2: