Lineage for d1visa2 (1vis A:181-313)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910699Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910721Family d.58.26.3: Mevalonate kinase [75450] (1 protein)
  6. 1910722Protein Mevalonate kinase [75451] (3 species)
  7. 1910728Species Methanococcus jannaschii [TaxId:2190] [75452] (2 PDB entries)
  8. 1910730Domain d1visa2: 1vis A:181-313 [100770]
    Other proteins in same PDB: d1visa1
    structural genomics
    complexed with dio

Details for d1visa2

PDB Entry: 1vis (more details), 2.69 Å

PDB Description: crystal structure of mevalonate kinase
PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d1visa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1visa2 d.58.26.3 (A:181-313) Mevalonate kinase {Methanococcus jannaschii [TaxId: 2190]}
eflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknkedfgklm
tknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekellkelnk
edvrifncrmmne

SCOPe Domain Coordinates for d1visa2:

Click to download the PDB-style file with coordinates for d1visa2.
(The format of our PDB-style files is described here.)

Timeline for d1visa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1visa1