![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.26.3: Mevalonate kinase [75450] (1 protein) |
![]() | Protein Mevalonate kinase [75451] (2 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [75452] (2 PDB entries) |
![]() | Domain d1visa2: 1vis A:181-313 [100770] Other proteins in same PDB: d1visa1 structural genomics complexed with dox |
PDB Entry: 1vis (more details), 2.69 Å
SCOP Domain Sequences for d1visa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1visa2 d.58.26.3 (A:181-313) Mevalonate kinase {Archaeon Methanococcus jannaschii} eflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknkedfgklm tknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekellkelnk edvrifncrmmne
Timeline for d1visa2: