Lineage for d1visa2 (1vis A:181-313)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) 
common fold is elaborated with additional secondary structures
Family d.58.26.3: Mevalonate kinase [75450] (1 protein) Protein Mevalonate kinase [75451] (2 species) Species Archaeon Methanococcus jannaschii [TaxId:2190] [75452] (2 PDB entries) 
Domain d1visa2: 1vis A:181-313 [100770]
Other proteins in same PDB: d1visa1
structural genomics
complexed with dox
Details for d1visa2
PDB Entry: 1vis (more details), 2.69 Å
PDB Description: crystal structure of mevalonate kinase
SCOP Domain Sequences for d1visa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1visa2 d.58.26.3 (A:181-313) Mevalonate kinase {Archaeon Methanococcus jannaschii}
eflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknkedfgklm
tknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekellkelnk
edvrifncrmmne
SCOP Domain Coordinates for d1visa2:
Click to download the PDB-style file with coordinates for d1visa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1visa2:
- d1visa2 is new in SCOP 1.67
- d1visa2 appears in SCOP 1.69
- d1visa2 appears in the current release, SCOPe 2.08
View in 3D
