Lineage for d1viab1 (1via B:4-165)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109815Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 protein domains)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2109816Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2109817Species Campylobacter jejuni [TaxId:197] [102345] (1 PDB entry)
  8. 2109819Domain d1viab1: 1via B:4-165 [100755]
    Other proteins in same PDB: d1viab2, d1viab3
    structural genomics
    complexed with so4

Details for d1viab1

PDB Entry: 1via (more details), 1.57 Å

PDB Description: crystal structure of shikimate kinase
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d1viab1:

Sequence, based on SEQRES records: (download)

>d1viab1 c.37.1.2 (B:4-165) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}
aknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffreqe
qkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrldkdeiskrplfyd
eikakklynerlskyeqkanfilnienknidellseikkvik

Sequence, based on observed residues (ATOM records): (download)

>d1viab1 c.37.1.2 (B:4-165) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}
aknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffreqe
qkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrlydeikakklyner
lskyeqkanfilnienknidellseikkvik

SCOPe Domain Coordinates for d1viab1:

Click to download the PDB-style file with coordinates for d1viab1.
(The format of our PDB-style files is described here.)

Timeline for d1viab1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1viaa_