PDB entry 1via

View 1via on RCSB PDB site
Description: Crystal structure of shikimate kinase
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AroK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIB5 (Start-164)
      • modified residue (12)
      • modified residue (65)
    Domains in SCOPe 2.07: d1viaa_
  • Chain 'B':
    Compound: Shikimate kinase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: AroK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PIB5 (3-164)
      • cloning artifact (1-2)
      • modified residue (12)
      • modified residue (65)
      • cloning artifact (165)
    Domains in SCOPe 2.07: d1viab1, d1viab2, d1viab3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1viaA (A:)
    mslaknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffr
    eqeqkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrldkdeiskrpl
    fydeikakklynerlskyeqkanfilnienknidellseikkvikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viaA (A:)
    knivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffreqeq
    kmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrldkdeiskrplfyde
    ikakklynerlskyeqkanfilnienknidellseikkvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1viaB (B:)
    mslaknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffr
    eqeqkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrldkdeiskrpl
    fydeikakklynerlskyeqkanfilnienknidellseikkvikeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viaB (B:)
    slaknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffre
    qeqkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrlydeikakklyn
    erlskyeqkanfilnienknidellseikkvike