Lineage for d1viab_ (1via B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393618Family c.37.1.2: Shikimate kinase (AroK) [52566] (1 protein)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 393619Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 393620Species Campylobacter jejuni [TaxId:197] [102345] (1 PDB entry)
  8. 393622Domain d1viab_: 1via B: [100755]
    structural genomics
    complexed with so4

Details for d1viab_

PDB Entry: 1via (more details), 1.57 Å

PDB Description: crystal structure of shikimate kinase

SCOP Domain Sequences for d1viab_:

Sequence, based on SEQRES records: (download)

>d1viab_ c.37.1.2 (B:) Shikimate kinase (AroK) {Campylobacter jejuni}
slaknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffre
qeqkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrldkdeiskrplf
ydeikakklynerlskyeqkanfilnienknidellseikkvike

Sequence, based on observed residues (ATOM records): (download)

>d1viab_ c.37.1.2 (B:) Shikimate kinase (AroK) {Campylobacter jejuni}
slaknivfigfmgsgkstlaralakdldlvfldsdflieqkfnqkvseifeqkrenffre
qeqkmadffsscekaciatgggfvnvsnlekagfciylkadfeylkkrlydeikakklyn
erlskyeqkanfilnienknidellseikkvike

SCOP Domain Coordinates for d1viab_:

Click to download the PDB-style file with coordinates for d1viab_.
(The format of our PDB-style files is described here.)

Timeline for d1viab_: