SCOPe 2.08: Domain d1vh8c1: 1vh8 C:2-158

Lineage for d1vh8c1 (1vh8 C:2-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Haemophilus influenzae [TaxId:727] [75479] (3 PDB entries)

8. Domain d1vh8c1: 1vh8 C:2-158 [100649]
   Other proteins in same PDB: d1vh8a2, d1vh8b2, d1vh8c2, d1vh8d2, d1vh8e2, d1vh8f2
   structural genomics
   complexed with acy, pop

Details for d1vh8c1

PDB Entry: 1vh8, 2.35 Å

PDB Description: Crystal structure of a 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1vh8c1:

Sequence, based on SEQRES records:

>d1vh8c1 d.79.5.1 (C:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedl
qcdieqvnvkattteklgftgrqegiaceavallirq

Sequence, based on observed residues (ATOM records):

>d1vh8c1 d.79.5.1 (C:2-158) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae [TaxId: 727]}
irighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigkl
fpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdieqv
nvkattteklgftgrqegiaceavallirq

Timeline for d1vh8c1:

• d1vh8c1 first appeared in SCOP 1.67, called d1vh8c_
  
• d1vh8c1 appears in SCOPe 2.07