PDB entry 1vh8

View 1vh8 on RCSB PDB site
Description: Crystal structure of a 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Class: Lyase
Keywords: structural genomics, Lyase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.24
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ISPF, HI0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (3-159)
      • cloning artifact (1-2)
      • modified residue (107)
      • modified residue (114)
    Domains in SCOPe 2.08: d1vh8a1, d1vh8a2
  • Chain 'B':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ISPF, HI0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (3-159)
      • cloning artifact (1-2)
      • modified residue (107)
      • modified residue (114)
    Domains in SCOPe 2.08: d1vh8b1, d1vh8b2
  • Chain 'C':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ISPF, HI0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (3-159)
      • cloning artifact (1-2)
      • modified residue (107)
      • modified residue (114)
    Domains in SCOPe 2.08: d1vh8c1, d1vh8c2
  • Chain 'D':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ISPF, HI0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (3-159)
      • cloning artifact (1-2)
      • modified residue (107)
      • modified residue (114)
    Domains in SCOPe 2.08: d1vh8d1, d1vh8d2
  • Chain 'E':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ISPF, HI0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (3-159)
      • cloning artifact (1-2)
      • modified residue (107)
      • modified residue (114)
    Domains in SCOPe 2.08: d1vh8e1, d1vh8e2
  • Chain 'F':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: ISPF, HI0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (3-159)
      • cloning artifact (1-2)
      • modified residue (107)
      • modified residue (114)
    Domains in SCOPe 2.08: d1vh8f1, d1vh8f2
  • Heterogens: POP, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh8A (A:)
    mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
    gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
    edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh8A (A:)
    slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
    klfpknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdi
    eqvnvkattteklgftgrqegiaceavallirq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh8B (B:)
    mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
    gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
    edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh8B (B:)
    slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
    klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
    qvnvkattteklgftgrqegiaceavallirq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vh8C (C:)
    mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
    gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
    edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh8C (C:)
    slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
    klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
    qvnvkattteklgftgrqegiaceavallirq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vh8D (D:)
    mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
    gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
    edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh8D (D:)
    slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
    klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
    qvnvkattteklgftgrqegiaceavallirq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vh8E (E:)
    mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
    gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
    edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh8E (E:)
    slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
    klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
    qvnvkattteklgftgrqegiaceavallirq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vh8F (F:)
    mslirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdi
    gklfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakia
    edlqcdieqvnvkattteklgftgrqegiaceavallirqeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh8F (F:)
    slirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdig
    klfpnadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdie
    qvnvkattteklgftgrqegiaceavallirq