SCOP 1.67: Domain d1v7no1: 1v7n O:1-107

Lineage for d1v7no1 (1v7n O:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (18 PDB entries)

8. Domain d1v7no1: 1v7n O:1-107 [100474]
   Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl2, d1v7nm2, d1v7nn2, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_
   part of anti-trombopoetin Fab tn1
   mutant

Details for d1v7no1

PDB Entry: 1v7n, 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab

SCOP Domain Sequences for d1v7no1:

Sequence; same for both SEQRES and ATOM records:

>d1v7no1 b.1.1.1 (O:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikr

Timeline for d1v7no1:

• d1v7no1 is new in SCOP 1.67
  
• d1v7no1 appears in SCOP 1.69
  
• d1v7no1 appears in the current release, SCOPe 2.08