Lineage for d1v7nn1 (1v7n N:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363802Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (18 PDB entries)
  8. 363821Domain d1v7nn1: 1v7n N:1-107 [100472]
    Other proteins in same PDB: d1v7nh1, d1v7nh2, d1v7ni1, d1v7ni2, d1v7nj1, d1v7nj2, d1v7nk1, d1v7nk2, d1v7nl2, d1v7nm2, d1v7nn2, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_

Details for d1v7nn1

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab

SCOP Domain Sequences for d1v7nn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7nn1 b.1.1.1 (N:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikr

SCOP Domain Coordinates for d1v7nn1:

Click to download the PDB-style file with coordinates for d1v7nn1.
(The format of our PDB-style files is described here.)

Timeline for d1v7nn1: