![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
![]() | Domain d1v7nh2: 1v7n H:117-217 [100461] Other proteins in same PDB: d1v7nh1, d1v7ni1, d1v7nj1, d1v7nk1, d1v7nl1, d1v7nl2, d1v7nm1, d1v7nm2, d1v7nn1, d1v7nn2, d1v7no1, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_ |
PDB Entry: 1v7n (more details), 3.3 Å
SCOP Domain Sequences for d1v7nh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7nh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
Timeline for d1v7nh2: