Lineage for d1v7nh2 (1v7n H:117-217)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365485Domain d1v7nh2: 1v7n H:117-217 [100461]
    Other proteins in same PDB: d1v7nh1, d1v7ni1, d1v7nj1, d1v7nk1, d1v7nl1, d1v7nl2, d1v7nm1, d1v7nm2, d1v7nn1, d1v7nn2, d1v7no1, d1v7no2, d1v7nv_, d1v7nx_, d1v7ny_, d1v7nz_

Details for d1v7nh2

PDB Entry: 1v7n (more details), 3.3 Å

PDB Description: human thrombopoietin functional domain complexed to neutralizing antibody tn1 fab

SCOP Domain Sequences for d1v7nh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7nh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1v7nh2:

Click to download the PDB-style file with coordinates for d1v7nh2.
(The format of our PDB-style files is described here.)

Timeline for d1v7nh2: