Lineage for d1v3qe_ (1v3q E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173040Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1173041Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1173151Protein Purine nucleoside phosphorylase, PNP [53169] (11 species)
  7. 1173272Species Human (Homo sapiens) [TaxId:9606] [53170] (27 PDB entries)
    Uniprot P00491
  8. 1173298Domain d1v3qe_: 1v3q E: [100290]
    complexed with 2di, so4

Details for d1v3qe_

PDB Entry: 1v3q (more details), 2.8 Å

PDB Description: Structure of human PNP complexed with DDI
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1v3qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3qe_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas

SCOPe Domain Coordinates for d1v3qe_:

Click to download the PDB-style file with coordinates for d1v3qe_.
(The format of our PDB-style files is described here.)

Timeline for d1v3qe_: