Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Purine nucleoside phosphorylase, PNP [53169] (14 species) |
Species Human (Homo sapiens) [TaxId:9606] [53170] (29 PDB entries) Uniprot P00491 |
Domain d1v3qe_: 1v3q E: [100290] complexed with 2di, so4 |
PDB Entry: 1v3q (more details), 2.8 Å
SCOPe Domain Sequences for d1v3qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v3qe_ c.56.2.1 (E:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]} engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas
Timeline for d1v3qe_: