PDB entry 1v3q

View 1v3q on RCSB PDB site
Description: Structure of human PNP complexed with DDI
Class: transferase
Keywords: purine nucleoside phosphorylase, drug design, synchrotorn, DDI, TRANSFERASE
Deposited on 2003-11-04, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v3qe_
  • Heterogens: SO4, 2DI, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v3qE (E:)
    engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
    pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
    pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
    geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas