| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class delta GST [81355] (6 species) formerly a part of class theta enzymes |
| Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [101208] (1 PDB entry) |
| Domain d1v2ac1: 1v2a C:84-205 [100267] Other proteins in same PDB: d1v2aa2, d1v2ab2, d1v2ac2, d1v2ad2 complexed with gts |
PDB Entry: 1v2a (more details), 2.15 Å
SCOPe Domain Sequences for d1v2ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v2ac1 a.45.1.1 (C:84-205) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}
kdpkvrsvvnqrlffdigtlykriidvihlvmkkeqpsdeqmeklkgaldlleqfvtera
yaaadhltvadicllgtvtalnwlkhdlepfphirawlervraempdyeefskqvaddtl
ay
Timeline for d1v2ac1: