Lineage for d1v2ad2 (1v2a D:1-83)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1600988Protein Class delta GST [81366] (6 species)
    formerly a part of class theta enzymes
  7. 1601009Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [102440] (1 PDB entry)
  8. 1601013Domain d1v2ad2: 1v2a D:1-83 [100270]
    Other proteins in same PDB: d1v2aa1, d1v2ab1, d1v2ac1, d1v2ad1
    complexed with gts

Details for d1v2ad2

PDB Entry: 1v2a (more details), 2.15 Å

PDB Description: Glutathione S-transferase 1-6 from Anopheles dirus species B
PDB Compounds: (D:) glutathione transferase gst1-6

SCOPe Domain Sequences for d1v2ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ad2 c.47.1.5 (D:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}
mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
vwesyaivlylvetyakddtlyp

SCOPe Domain Coordinates for d1v2ad2:

Click to download the PDB-style file with coordinates for d1v2ad2.
(The format of our PDB-style files is described here.)

Timeline for d1v2ad2: