SCOPe 2.08: Domain d1v2ac1: 1v2a C:84-205

Lineage for d1v2ac1 (1v2a C:84-205)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class delta GST [81355] (6 species)
   formerly a part of class theta enzymes

7. Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [101208] (1 PDB entry)

8. Domain d1v2ac1: 1v2a C:84-205 [100267]
   Other proteins in same PDB: d1v2aa2, d1v2ab2, d1v2ac2, d1v2ad2
   complexed with gts

Details for d1v2ac1

PDB Entry: 1v2a, 2.15 Å

PDB Description: Glutathione S-transferase 1-6 from Anopheles dirus species B

PDB Compounds: (C:) glutathione transferase gst1-6

SCOPe Domain Sequences for d1v2ac1:

Sequence; same for both SEQRES and ATOM records:

>d1v2ac1 a.45.1.1 (C:84-205) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}
kdpkvrsvvnqrlffdigtlykriidvihlvmkkeqpsdeqmeklkgaldlleqfvtera
yaaadhltvadicllgtvtalnwlkhdlepfphirawlervraempdyeefskqvaddtl
ay

Timeline for d1v2ac1:

• d1v2ac1 first appeared in SCOP 1.67
  
• d1v2ac1 appears in SCOPe 2.07