SCOPe 2.08: Domain d1uyya_: 1uyy A:

Lineage for d1uyya_ (1uyy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)

6. Protein Cellulase B (lichenase 5a) [101583] (1 species)

7. Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)

8. Domain d1uyya_: 1uyy A: [100212]
   CBM6-2; complexed with cellotriose
   complexed with ca

Details for d1uyya_

PDB Entry: 1uyy, 1.47 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellotriose

PDB Compounds: (A:) cellulase b

SCOPe Domain Sequences for d1uyya_:

Sequence; same for both SEQRES and ATOM records:

>d1uyya_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

Timeline for d1uyya_:

• d1uyya_ first appeared in SCOP 1.67
  
• d1uyya_ appears in SCOPe 2.07