![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
![]() | Protein Cellulase B (lichenase 5a) [101583] (1 species) |
![]() | Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries) |
![]() | Domain d1uyya_: 1uyy A: [100212] CBM6-2; complexed with cellotriose complexed with ca |
PDB Entry: 1uyy (more details), 1.47 Å
SCOPe Domain Sequences for d1uyya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyya_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus [TaxId: 39650]} mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw nlnwirinkth
Timeline for d1uyya_: