SCOP 1.67: Domain d1uyya_: 1uyy A:

Lineage for d1uyya_ (1uyy A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families)

5. Family b.18.1.10: CBM6 [69213] (3 proteins)

6. Protein Cellulase B (lichenase 5a) [101583] (1 species)

7. Species Cellvibrio mixtus [TaxId:39650] [101584] (6 PDB entries)

8. Domain d1uyya_: 1uyy A: [100212]

Details for d1uyya_

PDB Entry: 1uyy, 1.47 Å

PDB Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellotriose

SCOP Domain Sequences for d1uyya_:

Sequence; same for both SEQRES and ATOM records:

>d1uyya_ b.18.1.10 (A:) Cellulase B (lichenase 5a) {Cellvibrio mixtus}
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

Timeline for d1uyya_:

• d1uyya_ is new in SCOP 1.67
  
• d1uyya_ appears in SCOP 1.69
  
• d1uyya_ appears in the current release, SCOPe 2.08