PDB entry 1uyy

View 1uyy on RCSB PDB site
Description: Carbohydrate binding module (CBM6cm-2) from Cellvibrio mixtus lichenase 5A in complex with cellotriose
Class: carbohydrate binding module
Keywords: carbohydrate binding module, cbm6, mixed beta1, 3-1, 4 linked glucan, cellotriose
Deposited on 2004-03-03, released 2004-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase b
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYY (0-0)
    • Uniprot O07653 (1-130)
    Domains in SCOPe 2.08: d1uyya_
  • Chain 'B':
    Compound: cellulase b
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYY (0-0)
    • Uniprot O07653 (1-130)
    Domains in SCOPe 2.08: d1uyyb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uyyA (A:)
    mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
    vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
    nlnwirinkth
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uyyB (B:)
    mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
    vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
    nlnwirinkth