Lineage for d1uw3a_ (1uw3 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635625Protein Prion protein domain [54100] (14 species)
  7. 1635676Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
    Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228
  8. 1635677Domain d1uw3a_: 1uw3 A: [100070]
    complexed with gsh, po4

Details for d1uw3a_

PDB Entry: 1uw3 (more details), 2.04 Å

PDB Description: the crystal structure of the globular domain of sheep prion protein
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1uw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw3a_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]}
lggymlgsamsrplihfgndyedcyyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv
kqhtvttttkgenftetdikimervveqmcitqyqresqayyqrga

SCOPe Domain Coordinates for d1uw3a_:

Click to download the PDB-style file with coordinates for d1uw3a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw3a_: