Lineage for d5o6yb_ (5o6y B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850731Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 2850732Protein automated matches [195982] (7 species)
    not a true protein
  7. 2850740Species Bacillus cereus [TaxId:226900] [353696] (2 PDB entries)
  8. 2850746Domain d5o6yb_: 5o6y B: [353744]
    automated match to d4m1ba_
    complexed with 5ya, cl, dms, na, pe3, peg, pg0, so4, zn

Details for d5o6yb_

PDB Entry: 5o6y (more details), 2.5 Å

PDB Description: crystal structure of the bc1960 peptidoglycan n-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{n}-oxidanyl-benzamide
PDB Compounds: (B:) Peptidoglycan N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d5o6yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o6yb_ c.6.2.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
wtpfswvekyayafsgpynkaevaltfddgpdleftpkildklkqhnvkatffllgenae
kfpnivkrianeghvignhtyshpnlakvnedeyrnqiikteeilnrlagyapkfirpxy
geilenqlkwateqnfmivqwsvdtvdwkgvsadtitnnvlgnsfpgsvilqhstpgghl
qgsvdaldkiipqlktkgarfvtlpsmfqtsker

SCOPe Domain Coordinates for d5o6yb_:

Click to download the PDB-style file with coordinates for d5o6yb_.
(The format of our PDB-style files is described here.)

Timeline for d5o6yb_: