![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) ![]() in the different families beta-barrels are similarly distorted but may vary in the number of strands |
![]() | Family c.6.2.0: automated matches [195981] (1 protein) not a true family |
![]() | Protein automated matches [195982] (7 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [353696] (1 PDB entry) |
![]() | Domain d5o6yb_: 5o6y B: [353744] automated match to d4m1ba_ complexed with 5ya, cl, dms, na, pe3, peg, pg0, so4, zn |
PDB Entry: 5o6y (more details), 2.5 Å
SCOPe Domain Sequences for d5o6yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o6yb_ c.6.2.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]} wtpfswvekyayafsgpynkaevaltfddgpdleftpkildklkqhnvkatffllgenae kfpnivkrianeghvignhtyshpnlakvnedeyrnqiikteeilnrlagyapkfirpxy geilenqlkwateqnfmivqwsvdtvdwkgvsadtitnnvlgnsfpgsvilqhstpgghl qgsvdaldkiipqlktkgarfvtlpsmfqtsker
Timeline for d5o6yb_: