PDB entry 5o6y

View 5o6y on RCSB PDB site
Description: Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide
Class: hydrolase
Keywords: inhibitor, complex, deacetylase, peptidoglycan, HYDROLASE
Deposited on 2017-06-07, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan N-acetylglucosamine deacetylase
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_1960
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o6ya_
  • Chain 'B':
    Compound: Peptidoglycan N-acetylglucosamine deacetylase
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_1960
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o6yb_
  • Chain 'C':
    Compound: Peptidoglycan N-acetylglucosamine deacetylase
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_1960
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o6yc_
  • Chain 'D':
    Compound: Peptidoglycan N-acetylglucosamine deacetylase
    Species: Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) [TaxId:226900]
    Gene: BC_1960
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o6yd_
  • Heterogens: SO4, 5YA, PE3, PEG, PG0, NA, CL, ZN, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o6yA (A:)
    wtpfswvekyayafsgpynkaevaltfddgpdleftpkildklkqhnvkatffllgenae
    kfpnivkrianeghvignhtyshpnlakvnedeyrnqiikteeilnrlagyapkfirppy
    geilenqlkwateqnfmivqwsvdtvdwkgvsadtitnnvlgnsfpgsvilqhstpgghl
    qgsvdaldkiipqlktkgarfvtlpsmfqtsker
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o6yB (B:)
    wtpfswvekyayafsgpynkaevaltfddgpdleftpkildklkqhnvkatffllgenae
    kfpnivkrianeghvignhtyshpnlakvnedeyrnqiikteeilnrlagyapkfirpxy
    geilenqlkwateqnfmivqwsvdtvdwkgvsadtitnnvlgnsfpgsvilqhstpgghl
    qgsvdaldkiipqlktkgarfvtlpsmfqtsker
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o6yC (C:)
    wtpfswvekyayafsgpynkaevaltfddgpdleftpkildklkqhnvkatffllgenae
    kfpnivkrianeghvignhtyshpnlakvnedeyrnqiikteeilnrlagyapkfirpxy
    geilenqlkwateqnfmivqwsvdtvdwkgvsadtitnnvlgnsfpgsvilqhstpgghl
    qgsvdaldkiipqlktkgarfvtlpsmfqtsker
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o6yD (D:)
    wtpfswvekyayafsgpynkaevaltfddgpdleftpkildklkqhnvkatffllgenae
    kfpnivkrianeghvignhtyshpnlakvnedeyrnqiikteeilnrlagyapkfirpxy
    geilenqlkwateqnfmivqwsvdtvdwkgvsadtitnnvlgnsfpgsvilqhstpgghl
    qgsvdaldkiipqlktkgarfvtlpsmfqtsker