Lineage for d5mdha2 (5mdh A:155-333)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines familySuperfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866
Protein Malate dehydrogenase [56329] (12 species) 
Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries) 
Domain d5mdha2: 5mdh A:155-333 [42093]
Other proteins in same PDB: d5mdha1, d5mdhb1
complexed with mak, nad
Details for d5mdha2
PDB Entry: 5mdh (more details), 2.4 Å
PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution
PDB Compounds: (A:) malate dehydrogenaseSCOPe Domain Sequences for d5mdha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
trldhnrakaqialklgvtsddvknviiwgnhsstqypdvnhakvklqakevgvyeavkd
dswlkgefittvqqrgaavikarklssamsaakaicdhvrdiwfgtpegefvsmgiisdg
nsygvpddllysfpvtikdktwkiveglpindfsrekmdltakelaeeketafeflssa
SCOPe Domain Coordinates for d5mdha2:
Click to download the PDB-style file with coordinates for d5mdha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5mdha2:
- d5mdha2 first appeared (with stable ids) in SCOP 1.55
- d5mdha2 appears in SCOPe 2.07
View in 3D
