Lineage for d5mdha2 (5mdh A:155-333)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 37025Protein Malate dehydrogenase [56329] (7 species)
  7. 37042Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries)
  8. 37047Domain d5mdha2: 5mdh A:155-333 [42093]
    Other proteins in same PDB: d5mdha1, d5mdhb1

Details for d5mdha2

PDB Entry: 5mdh (more details), 2.4 Å

PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution

SCOP Domain Sequences for d5mdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa)}
trldhnrakaqialklgvtsddvknviiwgnhsstqypdvnhakvklqakevgvyeavkd
dswlkgefittvqqrgaavikarklssamsaakaicdhvrdiwfgtpegefvsmgiisdg
nsygvpddllysfpvtikdktwkiveglpindfsrekmdltakelaeeketafeflssa

SCOP Domain Coordinates for d5mdha2:

Click to download the PDB-style file with coordinates for d5mdha2.
(The format of our PDB-style files is described here.)

Timeline for d5mdha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mdha1