Lineage for d5fxda1 (5fxd A:2-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (13 species)
    not a true protein
  7. 2987754Species Rhodococcus jostii [TaxId:101510] [319925] (4 PDB entries)
  8. 2987755Domain d5fxda1: 5fxd A:2-238 [319988]
    Other proteins in same PDB: d5fxda2, d5fxdb2
    automated match to d1e0ya2
    complexed with fad, gol, h7y

Details for d5fxda1

PDB Entry: 5fxd (more details), 1.7 Å

PDB Description: crystal structure of eugenol oxidase in complex with isoeugenol
PDB Compounds: (A:) probable vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5fxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fxda1 d.145.1.0 (A:2-238) automated matches {Rhodococcus jostii [TaxId: 101510]}
trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrp

SCOPe Domain Coordinates for d5fxda1:

Click to download the PDB-style file with coordinates for d5fxda1.
(The format of our PDB-style files is described here.)

Timeline for d5fxda1:

2987755
d5fxda1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5fxda2