| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
| Family d.58.32.0: automated matches [227166] (1 protein) not a true family |
| Protein automated matches [226875] (6 species) not a true protein |
| Species Rhodococcus jostii [TaxId:101510] [319927] (4 PDB entries) |
| Domain d5fxda2: 5fxd A:239-526 [319989] Other proteins in same PDB: d5fxda1, d5fxdb1 automated match to d1e0ya1 complexed with fad, gol, h7y |
PDB Entry: 5fxd (more details), 1.7 Å
SCOPe Domain Sequences for d5fxda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fxda2 d.58.32.0 (A:239-526) automated matches {Rhodococcus jostii [TaxId: 101510]}
pasqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdg
pmpaeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddr
gghvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraney
nkdyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalm
ddvmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl
Timeline for d5fxda2: