![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
![]() | Protein automated matches [191143] (10 species) not a true protein |
![]() | Species Rhodococcus jostii [TaxId:101510] [319925] (4 PDB entries) |
![]() | Domain d5fxda1: 5fxd A:2-238 [319988] Other proteins in same PDB: d5fxda2, d5fxdb2 automated match to d1e0ya2 complexed with fad, gol, h7y |
PDB Entry: 5fxd (more details), 1.7 Å
SCOPe Domain Sequences for d5fxda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fxda1 d.145.1.0 (A:2-238) automated matches {Rhodococcus jostii [TaxId: 101510]} trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrp
Timeline for d5fxda1: