Lineage for d5dc9b_ (5dc9 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.0: automated matches [191562] (1 protein)
not a true familyProtein automated matches [190976] (5 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) 
Domain d5dc9b_: 5dc9 B: [313372]
Other proteins in same PDB: d5dc9a_
automated match to d3k2mc_
complexed with gol, imd
Details for d5dc9b_
PDB Entry: 5dc9 (more details), 1.56 Å
PDB Description: crystal structure of monobody as25/abl1 sh2 domain complex, crystal b
PDB Compounds: (B:) AS25 monobodySCOPe Domain Sequences for d5dc9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dc9b_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svsdvptklevvaatptslliswdapavtvdyyvitygetggwsgyqefevpgskstati
sglspgvdytitvyaygypyvkynkspisinyrt
SCOPe Domain Coordinates for d5dc9b_:
Click to download the PDB-style file with coordinates for d5dc9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5dc9b_:
- d5dc9b_ first appeared in SCOPe 2.06
- d5dc9b_ appears in SCOPe 2.07
View in 3D
