![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein automated matches [190202] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries) |
![]() | Domain d5dc9a_: 5dc9 A: [313361] Other proteins in same PDB: d5dc9b_ automated match to d3uyoa_ complexed with gol, imd |
PDB Entry: 5dc9 (more details), 1.56 Å
SCOPe Domain Sequences for d5dc9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dc9a_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas dgklyvssesrfntlaelvhhhstvadglittlhypapkr
Timeline for d5dc9a_: