PDB entry 5dc9

View 5dc9 on RCSB PDB site
Description: crystal structure of monobody as25/abl1 sh2 domain complex, crystal b
Class: protein binding
Keywords: engineered binding protein, antibody mimic, protein-protein complex, sh2 domain, tyrosine-protein kinase, protein binding
Deposited on 2015-08-23, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dc9a_
  • Chain 'B':
    Compound: AS25 monobody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DC9 (Start-94)
    Domains in SCOPe 2.07: d5dc9b_
  • Heterogens: GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dc9A (A:)
    gspsnyitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryeg
    rvyhyrintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygvs
    pny
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dc9A (A:)
    slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
    dgklyvssesrfntlaelvhhhstvadglittlhypapkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dc9B (B:)
    ssvsdvptklevvaatptslliswdapavtvdyyvitygetggwsgyqefevpgskstat
    isglspgvdytitvyaygypyvkynkspisinyrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dc9B (B:)
    svsdvptklevvaatptslliswdapavtvdyyvitygetggwsgyqefevpgskstati
    sglspgvdytitvyaygypyvkynkspisinyrt