Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Acinetobacter baumannii [TaxId:405416] [321244] (2 PDB entries) |
Domain d5d8da1: 5d8d A:2-98 [321245] Other proteins in same PDB: d5d8da2, d5d8db2, d5d8dc2, d5d8dd2, d5d8de2, d5d8df2 automated match to d4egjd1 |
PDB Entry: 5d8d (more details), 2.19 Å
SCOPe Domain Sequences for d5d8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d8da1 c.30.1.0 (A:2-98) automated matches {Acinetobacter baumannii [TaxId: 405416]} snatkfgkvavllggksaeravsldsgqavldallrsgvqaeafdpqdrsvtelvnydra fivlhgrggedgqiqgvlewlnipytgtgvqgsaigm
Timeline for d5d8da1: