Lineage for d5d8db1 (5d8d B:2-98)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862340Species Acinetobacter baumannii [TaxId:405416] [321244] (2 PDB entries)
  8. 2862342Domain d5d8db1: 5d8d B:2-98 [321663]
    Other proteins in same PDB: d5d8da2, d5d8db2, d5d8dc2, d5d8dd2, d5d8de2, d5d8df2
    automated match to d4egjd1

Details for d5d8db1

PDB Entry: 5d8d (more details), 2.19 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5d8db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8db1 c.30.1.0 (B:2-98) automated matches {Acinetobacter baumannii [TaxId: 405416]}
snatkfgkvavllggksaeravsldsgqavldallrsgvqaeafdpqdrsvtelvnydra
fivlhgrggedgqiqgvlewlnipytgtgvqgsaigm

SCOPe Domain Coordinates for d5d8db1:

Click to download the PDB-style file with coordinates for d5d8db1.
(The format of our PDB-style files is described here.)

Timeline for d5d8db1: