![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (39 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:405416] [321246] (2 PDB entries) |
![]() | Domain d5d8db2: 5d8d B:99-304 [321664] Other proteins in same PDB: d5d8da1, d5d8db1, d5d8dc1, d5d8dd1, d5d8de1, d5d8df1 automated match to d4egjc2 |
PDB Entry: 5d8d (more details), 2.19 Å
SCOPe Domain Sequences for d5d8db2:
Sequence, based on SEQRES records: (download)
>d5d8db2 d.142.1.0 (B:99-304) automated matches {Acinetobacter baumannii [TaxId: 405416]} dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhegssvgmskvekaed faaaiekatqhdavvmaekwitgreftisflngqplpvirlqppadvafydyeakyqrnd veygipcglseteekklqalclrafqavgaegwgridamqdeqgnfwllevntvpgmtsh slvpkaakavgysfdelcvaileqtl
>d5d8db2 d.142.1.0 (B:99-304) automated matches {Acinetobacter baumannii [TaxId: 405416]} dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhessvgmskvekaedf aaaiekatqhdavvmaekwitgreftisflngqplpvirlqygipcglseteekklqalc lrafqavgaegwgridamqdeqgnfwllevntvpgmtshslvpkaakavgysfdelcvai leqtl
Timeline for d5d8db2: