Lineage for d4uoaa_ (4uoa A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) 
Protein automated matches [190291] (19 species)
not a true protein
Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries) 
Domain d4uoaa_: 4uoa A: [258570]
Other proteins in same PDB: d4uoab_
automated match to d1hgea_
complexed with nag, so4; mutant
Details for d4uoaa_
PDB Entry: 4uoa (more details), 2.5 Å
PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin met29ile mutant
PDB Compounds: (A:) ha1SCOPe Domain Sequences for d4uoaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uoaa_ b.19.1.2 (A:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
qnpsgnntatlclghhavangtlvktisddqievtnatelvqsismgkicnksyrildgr
nctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtvefta
egftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgi
hhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdi
lminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvty
gkcpkyirqntlklatgmrnvpek
SCOPe Domain Coordinates for d4uoaa_:
Click to download the PDB-style file with coordinates for d4uoaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4uoaa_:
- d4uoaa_ first appeared in SCOPe 2.04
- d4uoaa_ appears in SCOPe 2.07
View in 3D
