SCOPe 2.04: Domain d4uoaa_: 4uoa A:

Lineage for d4uoaa_ (4uoa A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (23 species)
   not a true protein

7. Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258569] (1 PDB entry)

8. Domain d4uoaa_: 4uoa A: [258570]
   Other proteins in same PDB: d4uoab_
   automated match to d1hgea_
   complexed with nag, so4; mutant

Details for d4uoaa_

PDB Entry: 4uoa, 2.5 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin met29ile mutant

PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d4uoaa_:

Sequence; same for both SEQRES and ATOM records:

>d4uoaa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
qnpsgnntatlclghhavangtlvktisddqievtnatelvqsismgkicnksyrildgr
nctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtvefta
egftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgi
hhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdi
lminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvty
gkcpkyirqntlklatgmrnvpek

Timeline for d4uoaa_:

• d4uoaa_ is new in SCOPe 2.04-stable
  
• d4uoaa_ appears in SCOPe 2.05
  
• d4uoaa_ appears in the current release, SCOPe 2.08