Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (23 species) not a true protein |
Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258569] (1 PDB entry) |
Domain d4uoaa_: 4uoa A: [258570] Other proteins in same PDB: d4uoab_ automated match to d1hgea_ complexed with nag, so4; mutant |
PDB Entry: 4uoa (more details), 2.5 Å
SCOPe Domain Sequences for d4uoaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uoaa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]} qnpsgnntatlclghhavangtlvktisddqievtnatelvqsismgkicnksyrildgr nctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtvefta egftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgi hhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdi lminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvty gkcpkyirqntlklatgmrnvpek
Timeline for d4uoaa_: