Lineage for d4uoaa_ (4uoa A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385679Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries)
  8. 2385683Domain d4uoaa_: 4uoa A: [258570]
    Other proteins in same PDB: d4uoab_
    automated match to d1hgea_
    complexed with nag, so4; mutant

Details for d4uoaa_

PDB Entry: 4uoa (more details), 2.5 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin met29ile mutant
PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d4uoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uoaa_ b.19.1.2 (A:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
qnpsgnntatlclghhavangtlvktisddqievtnatelvqsismgkicnksyrildgr
nctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtvefta
egftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgi
hhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdi
lminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvty
gkcpkyirqntlklatgmrnvpek

SCOPe Domain Coordinates for d4uoaa_:

Click to download the PDB-style file with coordinates for d4uoaa_.
(The format of our PDB-style files is described here.)

Timeline for d4uoaa_: