PDB entry 4uoa

View 4uoa on RCSB PDB site
Description: Structure of the A_Canine_Colorado_17864_06 H3 haemagglutinin Met29Ile mutant
Class: viral protein
Keywords: viral protein, equine
Deposited on 2014-05-31, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23913
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ha1
    Species: INFLUENZA A VIRUS (A/CANINE/COLORADO/17864/2006(H3N8)) [TaxId:867285]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0UVR5 (0-End)
      • engineered mutation (26)
    Domains in SCOPe 2.07: d4uoaa_
  • Chain 'B':
    Compound: ha2
    Species: INFLUENZA A VIRUS (A/CANINE/COLORADO/17864/2006(H3N8)) [TaxId:867285]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0UVR5 (0-171)
      • conflict (130)
      • conflict (160)
    Domains in SCOPe 2.07: d4uoab_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uoaA (A:)
    qnpsgnntatlclghhavangtlvktisddqievtnatelvqsismgkicnksyrildgr
    nctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtvefta
    egftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgi
    hhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdi
    lminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvty
    gkcpkyirqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uoaA (A:)
    qnpsgnntatlclghhavangtlvktisddqievtnatelvqsismgkicnksyrildgr
    nctlidamlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtvefta
    egftwtgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgi
    hhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdi
    lminsngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvty
    gkcpkyirqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uoaB (B:)
    gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
    ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyvyrdealnnrfqsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uoaB (B:)
    gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
    ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyvyrdealnnrfq