Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (15 proteins) |
Protein automated matches [190073] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [238473] (13 PDB entries) |
Domain d4omcb1: 4omc B:110-442 [263315] Other proteins in same PDB: d4omca2, d4omcb2, d4omcc2, d4omcd2, d4omce2, d4omcf2 automated match to d1p8ja2 complexed with ca, fmt, na |
PDB Entry: 4omc (more details), 2.3 Å
SCOPe Domain Sequences for d4omcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omcb1 c.41.1.1 (B:110-442) automated matches {Human (Homo sapiens) [TaxId: 9606]} yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan dwatngvgrkvshsygyglldagamvalaqnwt
Timeline for d4omcb1: