PDB entry 4omc

View 4omc on RCSB PDB site
Description: X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba
Class: hydrolase/hydrolase inhibitor
Keywords: pro-protein convertase, serine protease, competitive inhibitor, protease-inhibitor complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-01-27, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FUR, FURIN, PACE, PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omca1, d4omca2
  • Chain 'B':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FUR, FURIN, PACE, PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omcb1, d4omcb2
  • Chain 'C':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FUR, FURIN, PACE, PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omcc1, d4omcc2
  • Chain 'D':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FUR, FURIN, PACE, PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omcd1, d4omcd2
  • Chain 'E':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FUR, FURIN, PACE, PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omce1, d4omce2
  • Chain 'F':
    Compound: Furin
    Species: Homo sapiens [TaxId:9606]
    Gene: FUR, FURIN, PACE, PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4omcf1, d4omcf2
  • Chain 'H':
    Compound: meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine
    Database cross-references and differences (RAF-indexed):
    • PDB 4OMC (0-4)
  • Chain 'I':
    Compound: meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine
    Database cross-references and differences (RAF-indexed):
    • PDB 4OMC (0-4)
  • Chain 'J':
    Compound: meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine
    Database cross-references and differences (RAF-indexed):
    • PDB 4OMC (0-4)
  • Chain 'K':
    Compound: meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine
    Database cross-references and differences (RAF-indexed):
    • PDB 4OMC (0-4)
  • Chain 'L':
    Compound: meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine
    Database cross-references and differences (RAF-indexed):
    • PDB 4OMC (0-4)
  • Chain 'N':
    Compound: meta-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)benzamidine
    Database cross-references and differences (RAF-indexed):
    • PDB 4OMC (0-4)
  • Heterogens: FMT, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4omcA (A:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omcA (A:)
    vyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ndwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevr
    ktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgf
    ndwafmtthswdedpsgewvleientseannygtltkftlvlygta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4omcB (B:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omcB (B:)
    yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevrk
    tvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgfn
    dwafmtthswdedpsgewvleientseannygtltkftlvlygta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4omcC (C:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omcC (C:)
    vyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ndwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevr
    ktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgf
    ndwafmtthswdedpsgewvleientseannygtltkftlvlygta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4omcD (D:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omcD (D:)
    yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevrk
    tvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgfn
    dwafmtthswdedpsgewvleientseannygtltkftlvlygta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4omcE (E:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omcE (E:)
    yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevrk
    tvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgfn
    dwafmtthswdedpsgewvleientseannygtltkftlvlygta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4omcF (F:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    andwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlev
    rktvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadg
    fndwafmtthswdedpsgewvleientseannygtltkftlvlygtasgslvprgshhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4omcF (F:)
    yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciidiltepkdigkrlevrk
    tvtaclgepnhitrlehaqarltlsynrrgdlaihlvspmgtrstllaarphdysadgfn
    dwafmtthswdedpsgewvleientseannygtltkftlvlygta
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'N':
    No sequence available.