![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
![]() | Domain d4omce2: 4omc E:443-574 [263318] Other proteins in same PDB: d4omca1, d4omcb1, d4omcc1, d4omcd1, d4omce1, d4omcf1 automated match to d1p8ja1 complexed with ca, fmt, na |
PDB Entry: 4omc (more details), 2.3 Å
SCOPe Domain Sequences for d4omce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omce2 b.18.1.0 (E:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt ltkftlvlygta
Timeline for d4omce2: