Lineage for d4o5ob_ (4o5o B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (203 species)
not a true protein
Species Brucella suis [TaxId:204722] [230314] (1 PDB entry) 
Domain d4o5ob_: 4o5o B: [235847]
automated match to d4o5oa_
complexed with edo, trs, zn
Details for d4o5ob_
PDB Entry: 4o5o (more details), 1.4 Å
PDB Description: X-ray Crystal Structure of a 3-hydroxyacyl-CoA dehydrogenase from Brucella suis
PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenaseSCOPe Domain Sequences for d4o5ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o5ob_ c.2.1.0 (B:) automated matches {Brucella suis [TaxId: 204722]}
hhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasar
fqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisin
ligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlp
varelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvhhiv
enqmlngevirldgalrmaak
SCOPe Domain Coordinates for d4o5ob_:
Click to download the PDB-style file with coordinates for d4o5ob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4o5ob_:
- d4o5ob_ first appeared in SCOPe 2.03
- d4o5ob_ appears in SCOPe 2.04
- d4o5ob_ is called d4o5ob1 in SCOPe 2.06
- d4o5ob_ appears in the current release, SCOPe 2.08, called d4o5ob1
View in 3D
