PDB entry 4o5o

View 4o5o on RCSB PDB site
Description: X-ray Crystal Structure of a 3-hydroxyacyl-CoA dehydrogenase from Brucella suis
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, oxidoreductase
Deposited on 2013-12-19, released 2014-01-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.137
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella suis [TaxId:204722]
    Gene: BRA0449, BS1330_II0446
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FWK3 (8-262)
      • expression tag (1-7)
    Domains in SCOPe 2.05: d4o5oa_
  • Chain 'B':
    Compound: 3-hydroxyacyl-CoA dehydrogenase
    Species: Brucella suis [TaxId:204722]
    Gene: BRA0449, BS1330_II0446
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FWK3 (8-262)
      • expression tag (2-7)
    Domains in SCOPe 2.05: d4o5ob_
  • Heterogens: ZN, EDO, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o5oA (A:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvhh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5oA (A:)
    ahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasa
    rfqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisi
    nligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtl
    pvarelarhgirvmtiapgifktpmmavqdalgasvpfpprlgepaeyaalvhhivenqm
    lngevirldgalrmaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o5oB (B:)
    mahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgas
    arfqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtis
    inligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamt
    lpvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvhh
    ivenqmlngevirldgalrmaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5oB (B:)
    hhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasar
    fqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisin
    ligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtlp
    varelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvhhiv
    enqmlngevirldgalrmaak