Lineage for d4o5oa_ (4o5o A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830854Species Brucella suis [TaxId:204722] [230314] (1 PDB entry)
  8. 1830855Domain d4o5oa_: 4o5o A: [230315]
    automated match to d4dmla_
    complexed with edo, trs, zn

Details for d4o5oa_

PDB Entry: 4o5o (more details), 1.4 Å

PDB Description: X-ray Crystal Structure of a 3-hydroxyacyl-CoA dehydrogenase from Brucella suis
PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4o5oa_:

Sequence, based on SEQRES records: (download)

>d4o5oa_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 204722]}
ahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasa
rfqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisi
nligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtl
pvarelarhgirvmtiapgifktpmmagmpqevqdalgasvpfpprlgepaeyaalvhhi
venqmlngevirldgalrmaak

Sequence, based on observed residues (ATOM records): (download)

>d4o5oa_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 204722]}
ahhhhhhmqienrvflitgagsglgaavskmaveagakvvlldvnaeageagakalgasa
rfqrtdvasdtdgkaaiaaaieafgridvlvncagvapgekvlgregahkletftrtisi
nligtfnmlrlaaeamaknepgqggergviintasvaafdgqigqaaysaskggvaamtl
pvarelarhgirvmtiapgifktpmmavqdalgasvpfpprlgepaeyaalvhhivenqm
lngevirldgalrmaak

SCOPe Domain Coordinates for d4o5oa_:

Click to download the PDB-style file with coordinates for d4o5oa_.
(The format of our PDB-style files is described here.)

Timeline for d4o5oa_: